PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g033570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 276aa    MW: 31174.6 Da    PI: 10.23
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g033570.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind42.72e-1311321125
       GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki.....rernlalsekkaav...........aerd........maflqrdkalaern 71 
                     md+dg  +rn+gyyep+ +++ nlg+ql+ s  e+++k+     +++n+++++++  +            +rd        m++    ++l++  
  Csa07g033570.1   1 MDEDGLSNRNWGYYEPS-QFRPNLGFQLIPSSIEKNEKPfvvspQNQNQNFITPSVLYrgggsssslmsFPRDytasdapfMSY----SWLNQ-- 88 
                     9***************9.************999***********99***99999988866666666655444476766666666....78888.. PP

       GAGA_bind  72 kalverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsave 125
                         +rd+k++++++++ s      + +  +++t+ + +  ql +p+++d++ +
  Csa07g033570.1  89 ----HRDSKFFSNVPNNPS------NHTLLVPETSRMTQPMQLLQPEVKDESLK 132
                     ....9**********6654......23456677777666666677777777766 PP

2GAGA_bind271.54.3e-83129275148301
       GAGA_bind 148 kkkkkrqrakkpkekkakkkkkksekskkkvkkesad.erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSv 241
                     ++ k++++   pk++k+kk         k++++ +++ ers   +ksi++v+ngvs+D++ lPvPvCsCtG+++qCY+WG+GGWqSaCCtt++S+
  Csa07g033570.1 129 ESLKRKHQRGAPKANKEKKL--------KDNNMLRVQrERSPLFRKSIEMVINGVSMDIGCLPVPVCSCTGMPQQCYRWGCGGWQSACCTTNVSM 215
                     22222233333444444444........44445444448899***************************************************** PP

       GAGA_bind 242 yPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     yPLP+s+krrgaRiagrKmSqgaf+k+LekL+a+G+d+s p+DLk+hWAkHGtnkfvtir
  Csa07g033570.1 216 YPLPISAKRRGARIAGRKMSQGAFRKVLEKLSADGFDFSIPIDLKSHWAKHGTNKFVTIR 275
                     ***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.3E-811275IPR010409GAGA-binding transcriptional activator
SMARTSM012265.7E-1381275IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MDEDGLSNRN WGYYEPSQFR PNLGFQLIPS SIEKNEKPFV VSPQNQNQNF ITPSVLYRGG  60
GSSSSLMSFP RDYTASDAPF MSYSWLNQHR DSKFFSNVPN NPSNHTLLVP ETSRMTQPMQ  120
LLQPEVKDES LKRKHQRGAP KANKEKKLKD NNMLRVQRER SPLFRKSIEM VINGVSMDIG  180
CLPVPVCSCT GMPQQCYRWG CGGWQSACCT TNVSMYPLPI SAKRRGARIA GRKMSQGAFR  240
KVLEKLSADG FDFSIPIDLK SHWAKHGTNK FVTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0125631e-145AC012563.7 Arabidopsis thaliana chromosome 1 BAC T23K23 genomic sequence, complete sequence.
GenBankAY3805691e-145AY380569.1 Arabidopsis thaliana basic pentacysteine 3 (BPC3) mRNA, complete cds.
GenBankBT0221171e-145BT022117.1 Arabidopsis thaliana At1g68120 mRNA, complete cds.
GenBankCP0026841e-145CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010415406.10.0PREDICTED: protein BASIC PENTACYSTEINE3-like
RefseqXP_010415407.10.0PREDICTED: protein BASIC PENTACYSTEINE3-like
SwissprotQ9C9X61e-155BPC3_ARATH; Protein BASIC PENTACYSTEINE3
TrEMBLR0GFA21e-170R0GFA2_9BRAS; Uncharacterized protein
STRINGAT1G68120.11e-153(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM153471518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68120.11e-146basic pentacysteine 3